SCOPe 2.07: Domain d4k11a3: 4k11 A:249-531

Lineage for d4k11a3 (4k11 A:249-531)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein c-src tyrosine kinase [56155] (3 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56156] (13 PDB entries)

8. Domain d4k11a3: 4k11 A:249-531 [253134]
   Other proteins in same PDB: d4k11a1, d4k11a2
   automated match to d1fmka3
   complexed with 0j9

Details for d4k11a3

PDB Entry: 4k11, 2.3 Å

PDB Description: the structure of 1na in complex with src t338g

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d4k11a3:

Sequence; same for both SEQRES and ATOM records:

>d4k11a3 d.144.1.7 (A:249-531) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
kpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeafl
qeaqvmkklrheklvqlyavvseepiyivgeymskgslldflkgetgkylrlpqlvdmaa
qiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikw
tapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecp
eslhdlmcqcwrkepeerptfeylqafledyftstepqyqpge

Timeline for d4k11a3:

• d4k11a3 first appeared in SCOPe 2.04
  
• d4k11a3 appears in SCOPe 2.06
  
• d4k11a3 appears in the current release, SCOPe 2.08