![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
![]() | Protein c-src tyrosine kinase [55556] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55557] (46 PDB entries) |
![]() | Domain d4k11a2: 4k11 A:146-248 [253133] Other proteins in same PDB: d4k11a1, d4k11a3 automated match to d1fmka2 complexed with 0j9 |
PDB Entry: 4k11 (more details), 2.3 Å
SCOPe Domain Sequences for d4k11a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k11a2 d.93.1.1 (A:146-248) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} eewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhykir kldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpts
Timeline for d4k11a2: