![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein c-src protein tyrosine kinase [50064] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50065] (6 PDB entries) |
![]() | Domain d4k11a1: 4k11 A:84-145 [253132] Other proteins in same PDB: d4k11a2, d4k11a3 automated match to d1fmka1 complexed with 0j9 |
PDB Entry: 4k11 (more details), 2.3 Å
SCOPe Domain Sequences for d4k11a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k11a1 b.34.2.1 (A:84-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} ttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsdsi qa
Timeline for d4k11a1: