Lineage for d4k11a1 (4k11 A:84-145)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536113Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1536114Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1536201Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 1536215Species Human (Homo sapiens) [TaxId:9606] [50065] (6 PDB entries)
  8. 1536220Domain d4k11a1: 4k11 A:84-145 [253132]
    Other proteins in same PDB: d4k11a2, d4k11a3
    automated match to d1fmka1
    complexed with 0j9

Details for d4k11a1

PDB Entry: 4k11 (more details), 2.3 Å

PDB Description: the structure of 1na in complex with src t338g
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d4k11a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k11a1 b.34.2.1 (A:84-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
ttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsdsi
qa

SCOPe Domain Coordinates for d4k11a1:

Click to download the PDB-style file with coordinates for d4k11a1.
(The format of our PDB-style files is described here.)

Timeline for d4k11a1: