Lineage for d1b70b3 (1b70 B:39-151)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 297373Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) (S)
  5. 297568Family b.40.4.4: Myf domain [50277] (6 proteins)
  6. 297578Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)
  7. 297579Species Thermus thermophilus (Thermus aquaticus) [50279] (5 PDB entries)
  8. 297583Domain d1b70b3: 1b70 B:39-151 [25313]
    Other proteins in same PDB: d1b70a_, d1b70b1, d1b70b2, d1b70b4, d1b70b5, d1b70b6

Details for d1b70b3

PDB Entry: 1b70 (more details), 2.7 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalanine

SCOP Domain Sequences for d1b70b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b70b3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

SCOP Domain Coordinates for d1b70b3:

Click to download the PDB-style file with coordinates for d1b70b3.
(The format of our PDB-style files is described here.)

Timeline for d1b70b3: