SCOP 1.59: Domain d1b70b3: 1b70 B:39-151

Lineage for d1b70b3 (1b70 B:39-151)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families)

5. Family b.40.4.4: Myf domain [50277] (3 proteins)

6. Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)

7. Species Thermus thermophilus (Thermus aquaticus) [50279] (5 PDB entries)

8. Domain d1b70b3: 1b70 B:39-151 [25313]
   Other proteins in same PDB: d1b70a_, d1b70b1, d1b70b2, d1b70b4, d1b70b5, d1b70b6

Details for d1b70b3

PDB Entry: 1b70, 2.7 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalanine

SCOP Domain Sequences for d1b70b3:

Sequence; same for both SEQRES and ATOM records:

>d1b70b3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

Timeline for d1b70b3:

• d1b70b3 first appeared (with stable ids) in SCOP 1.55
  
• d1b70b3 appears in SCOP 1.57
  
• d1b70b3 appears in SCOP 1.61
  
• d1b70b3 appears in the current release, SCOPe 2.08