SCOPe 2.04: Domain d4jypa_: 4jyp A:

Lineage for d4jypa_ (4jyp A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (56 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188958] (8 PDB entries)

8. Domain d4jypa_: 4jyp A: [253129]
   automated match to d1woma_

Details for d4jypa_

PDB Entry: 4jyp, 1.3 Å

PDB Description: crystal Structure of KAI2 Apo form

PDB Compounds: (A:) Hydrolase, alpha/beta fold family protein

SCOPe Domain Sequences for d4jypa_:

Sequence; same for both SEQRES and ATOM records:

>d4jypa_ c.69.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagttnpdy
fdfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivmisas
pryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrtlfnm
rpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesvvevi
psdghlpqlsspdsvipvilrhirndi

Timeline for d4jypa_:

• d4jypa_ is new in SCOPe 2.04-stable
  
• d4jypa_ appears in SCOPe 2.05
  
• d4jypa_ appears in the current release, SCOPe 2.08