Lineage for d4jypa_ (4jyp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2903116Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188958] (22 PDB entries)
  8. 2903118Domain d4jypa_: 4jyp A: [253129]
    automated match to d1woma_

Details for d4jypa_

PDB Entry: 4jyp (more details), 1.3 Å

PDB Description: crystal Structure of KAI2 Apo form
PDB Compounds: (A:) Hydrolase, alpha/beta fold family protein

SCOPe Domain Sequences for d4jypa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jypa_ c.69.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagttnpdy
fdfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivmisas
pryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrtlfnm
rpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesvvevi
psdghlpqlsspdsvipvilrhirndi

SCOPe Domain Coordinates for d4jypa_:

Click to download the PDB-style file with coordinates for d4jypa_.
(The format of our PDB-style files is described here.)

Timeline for d4jypa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4jypb_