| Class b: All beta proteins [48724] (174 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
| Family b.40.4.4: Myf domain [50277] (7 proteins) |
| Protein Domain B2 of PheRS-beta, PheT [50278] (1 species) |
| Species Thermus thermophilus [TaxId:274] [50279] (9 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
| Domain d1b7yb3: 1b7y B:39-151 [25312] Other proteins in same PDB: d1b7ya_, d1b7yb1, d1b7yb2, d1b7yb4, d1b7yb5, d1b7yb6 protein/RNA complex; complexed with fya, mg |
PDB Entry: 1b7y (more details), 2.5 Å
SCOPe Domain Sequences for d1b7yb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b7yb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp
Timeline for d1b7yb3: