SCOP 1.61: Domain d1b7yb3: 1b7y B:39-151

Lineage for d1b7yb3 (1b7y B:39-151)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families)

5. Family b.40.4.4: Myf domain [50277] (3 proteins)

6. Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)

7. Species Thermus thermophilus (Thermus aquaticus) [50279] (5 PDB entries)

8. Domain d1b7yb3: 1b7y B:39-151 [25312]
   Other proteins in same PDB: d1b7ya_, d1b7yb1, d1b7yb2, d1b7yb4, d1b7yb5, d1b7yb6

Details for d1b7yb3

PDB Entry: 1b7y, 2.5 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalaninyl-adenylate

SCOP Domain Sequences for d1b7yb3:

Sequence; same for both SEQRES and ATOM records:

>d1b7yb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

Timeline for d1b7yb3:

• d1b7yb3 first appeared (with stable ids) in SCOP 1.55
  
• d1b7yb3 appears in SCOP 1.59
  
• d1b7yb3 appears in SCOP 1.63
  
• d1b7yb3 appears in the current release, SCOPe 2.08