Lineage for d1b7yb3 (1b7y B:39-151)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59438Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 59542Family b.40.4.4: Myf domain [50277] (3 proteins)
  6. 59549Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)
  7. 59550Species Thermus thermophilus (Thermus aquaticus) [50279] (4 PDB entries)
  8. 59552Domain d1b7yb3: 1b7y B:39-151 [25312]
    Other proteins in same PDB: d1b7ya_, d1b7yb1, d1b7yb2, d1b7yb4, d1b7yb5, d1b7yb6

Details for d1b7yb3

PDB Entry: 1b7y (more details), 2.5 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalaninyl-adenylate

SCOP Domain Sequences for d1b7yb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7yb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

SCOP Domain Coordinates for d1b7yb3:

Click to download the PDB-style file with coordinates for d1b7yb3.
(The format of our PDB-style files is described here.)

Timeline for d1b7yb3: