SCOPe 2.08: Domain d4jv1a1: 4jv1 A:1-240

Lineage for d4jv1a1 (4jv1 A:1-240)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
   contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein DinB homolog (DBH) [100889] (3 species)

7. Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (41 PDB entries)

8. Domain d4jv1a1: 4jv1 A:1-240 [253114]
   Other proteins in same PDB: d4jv1a2
   automated match to d4juza1
   protein/DNA complex; complexed with ca, dgt

Details for d4jv1a1

PDB Entry: 4jv1, 2.3 Å

PDB Description: Ternary complex of gamma-OHPDG adduct modified dna with dna (-1 primer) polymerase iv and incoming dgtp

PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d4jv1a1:

Sequence; same for both SEQRES and ATOM records:

>d4jv1a1 e.8.1.7 (A:1-240) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

Timeline for d4jv1a1:

• d4jv1a1 first appeared in SCOPe 2.04
  
• d4jv1a1 appears in SCOPe 2.07