SCOPe 2.08: Domain d4juje1: 4juj E:5-325

Lineage for d4juje1 (4juj E:5-325)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (22 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)

8. Domain d4juje1: 4juj E:5-325 [253112]
   Other proteins in same PDB: d4juja2, d4jujb_, d4jujc2, d4jujd_, d4juje2, d4jujf_
   automated match to d1rvth_
   mutant

Details for d4juje1

PDB Entry: 4juj, 3.01 Å

PDB Description: crystal structure of 1918 pandemic influenza virus hemagglutinin mutant d225g complexed with human receptor analogue lstc

PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4juje1:

Sequence; same for both SEQRES and ATOM records:

>d4juje1 b.19.1.2 (E:5-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
hpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgdti
tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
gecpkyvrstklrmatglrnip

Timeline for d4juje1:

• d4juje1 first appeared in SCOPe 2.04, called d4juje_
  
• d4juje1 appears in SCOPe 2.07