Lineage for d1pysb3 (1pys B:39-151)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59438Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 59542Family b.40.4.4: Myf domain [50277] (3 proteins)
  6. 59549Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)
  7. 59550Species Thermus thermophilus (Thermus aquaticus) [50279] (4 PDB entries)
  8. 59551Domain d1pysb3: 1pys B:39-151 [25311]
    Other proteins in same PDB: d1pysa_, d1pysb1, d1pysb2, d1pysb4, d1pysb5, d1pysb6

Details for d1pysb3

PDB Entry: 1pys (more details), 2.9 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus

SCOP Domain Sequences for d1pysb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pysb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

SCOP Domain Coordinates for d1pysb3:

Click to download the PDB-style file with coordinates for d1pysb3.
(The format of our PDB-style files is described here.)

Timeline for d1pysb3: