![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.4: Myf domain [50277] (7 proteins) |
![]() | Protein Domain B2 of PheRS-beta, PheT [50278] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [50279] (12 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
![]() | Domain d1pysb3: 1pys B:39-151 [25311] Other proteins in same PDB: d1pysa_, d1pysb1, d1pysb2, d1pysb4, d1pysb5, d1pysb6 complexed with mg |
PDB Entry: 1pys (more details), 2.9 Å
SCOPe Domain Sequences for d1pysb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pysb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]} fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp
Timeline for d1pysb3: