SCOPe 2.03: Domain d1otcb_: 1otc B:

Lineage for d1otcb_ (1otc B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
   barrel, closed; n=5, S=10

6. Protein Core domain of telomere end binding protein beta subunit [50275] (1 species)

7. Species Oxytricha nova [TaxId:200597] [50276] (14 PDB entries)

8. Domain d1otcb_: 1otc B: [25310]
   Other proteins in same PDB: d1otca1, d1otca2, d1otca3
   protein/DNA complex

Details for d1otcb_

PDB Entry: 1otc, 2.8 Å

PDB Description: the o. nova telomere end binding protein complexed with single strand dna

PDB Compounds: (B:) protein (telomere-binding protein beta subunit)

SCOPe Domain Sequences for d1otcb_:

Sequence; same for both SEQRES and ATOM records:

>d1otcb_ b.40.4.3 (B:) Core domain of telomere end binding protein beta subunit {Oxytricha nova [TaxId: 200597]}
qqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeavn
efhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqerl
nptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdagi
vkasaskgdefsdfsfkegntatlkiadifvqe

Timeline for d1otcb_:

• d1otcb_ first appeared (with stable ids) in SCOP 1.55
  
• d1otcb_ appears in SCOPe 2.02
  
• d1otcb_ appears in SCOPe 2.04
  
• d1otcb_ appears in the current release, SCOPe 2.08