Lineage for d1otcb_ (1otc B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2051200Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 protein domains)
    barrel, closed; n=5, S=10
  6. 2051209Protein Core domain of telomere end binding protein beta subunit [50275] (1 species)
  7. 2051210Species Oxytricha nova [TaxId:200597] [50276] (14 PDB entries)
  8. 2051223Domain d1otcb_: 1otc B: [25310]
    Other proteins in same PDB: d1otca1, d1otca2, d1otca3
    protein/DNA complex

Details for d1otcb_

PDB Entry: 1otc (more details), 2.8 Å

PDB Description: the o. nova telomere end binding protein complexed with single strand dna
PDB Compounds: (B:) protein (telomere-binding protein beta subunit)

SCOPe Domain Sequences for d1otcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otcb_ b.40.4.3 (B:) Core domain of telomere end binding protein beta subunit {Oxytricha nova [TaxId: 200597]}
qqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeavn
efhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqerl
nptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdagi
vkasaskgdefsdfsfkegntatlkiadifvqe

SCOPe Domain Coordinates for d1otcb_:

Click to download the PDB-style file with coordinates for d1otcb_.
(The format of our PDB-style files is described here.)

Timeline for d1otcb_: