SCOPe 2.02: Domain d1otca3: 1otc A:329-495

Lineage for d1otca3 (1otc A:329-495)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
   barrel, closed; n=5, S=10

6. Protein Telomere end binding protein alpha subunit [50273] (1 species)
   duplication: consists of three domains of this fold

7. Species Oxytricha nova [TaxId:200597] [50274] (16 PDB entries)

8. Domain d1otca3: 1otc A:329-495 [25309]
   Other proteins in same PDB: d1otcb_
   protein/DNA complex

Details for d1otca3

PDB Entry: 1otc, 2.8 Å

PDB Description: the o. nova telomere end binding protein complexed with single strand dna

PDB Compounds: (A:) protein (telomere-binding protein alpha subunit)

SCOPe Domain Sequences for d1otca3:

Sequence; same for both SEQRES and ATOM records:

>d1otca3 b.40.4.3 (A:329-495) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]}
slnavvltevdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvk
gydrktkkssslkgasgkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvka
dnlhknadarkkledsaelltkfnsyvdavverrngfylikdtkliy

Timeline for d1otca3:

• d1otca3 first appeared (with stable ids) in SCOP 1.55
  
• d1otca3 appears in SCOPe 2.01
  
• d1otca3 appears in SCOPe 2.03
  
• d1otca3 appears in the current release, SCOPe 2.07