| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Domain d4jucb1: 4juc B:2-181 [253084] Other proteins in same PDB: d4juca2, d4jucb2, d4jucc2, d4jucd2 automated match to d2fwna2 complexed with ca, gol, tpp; mutant |
PDB Entry: 4juc (more details), 2.3 Å
SCOPe Domain Sequences for d4jucb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jucb1 c.36.1.0 (B:2-181) automated matches {Pseudomonas putida [TaxId: 303]}
asvhgttyellrrqgidtvfgnpgmnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
Timeline for d4jucb1: