![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins) barrel, closed; n=5, S=10 |
![]() | Protein Telomere end binding protein alpha subunit [50273] (1 species) duplication: consists of three domains of this fold |
![]() | Species Oxytricha nova [TaxId:200597] [50274] (15 PDB entries) |
![]() | Domain d1otca1: 1otc A:37-204 [25307] Other proteins in same PDB: d1otcb_ |
PDB Entry: 1otc (more details), 2.8 Å
SCOP Domain Sequences for d1otca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1otca1 b.40.4.3 (A:37-204) Telomere end binding protein alpha subunit {Oxytricha nova} eyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdasd yatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrsv tqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssys
Timeline for d1otca1: