Lineage for d4jtxk_ (4jtx K:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385197Protein Hemagglutinin [49824] (19 species)
    includes rudiment esterase domain
  7. 2385289Species Influenza A virus, different strains [TaxId:11320] [49825] (127 PDB entries)
  8. 2385472Domain d4jtxk_: 4jtx K: [253058]
    Other proteins in same PDB: d4jtxa2, d4jtxb_, d4jtxd_, d4jtxf_, d4jtxh_, d4jtxj_, d4jtxl_
    automated match to d1rd8a_
    complexed with nag; mutant

Details for d4jtxk_

PDB Entry: 4jtx (more details), 3 Å

PDB Description: crystal structure of 2009 pandemic influenza virus hemagglutinin mutant d225e
PDB Compounds: (K:) Hemagglutinin

SCOPe Domain Sequences for d4jtxk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jtxk_ b.19.1.2 (K:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrnip

SCOPe Domain Coordinates for d4jtxk_:

Click to download the PDB-style file with coordinates for d4jtxk_.
(The format of our PDB-style files is described here.)

Timeline for d4jtxk_: