Lineage for d4jtxf_ (4jtx F:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2267131Domain d4jtxf_: 4jtx F: [253053]
    Other proteins in same PDB: d4jtxa1, d4jtxa2, d4jtxc_, d4jtxe_, d4jtxg_, d4jtxi_, d4jtxk_
    automated match to d1rd8b_
    complexed with nag; mutant

Details for d4jtxf_

PDB Entry: 4jtx (more details), 3 Å

PDB Description: crystal structure of 2009 pandemic influenza virus hemagglutinin mutant d225e
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d4jtxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jtxf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmnt
qftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyek
vrsqlknnakeigngcfefyhkcdntcmesvkngtydypky

SCOPe Domain Coordinates for d4jtxf_:

Click to download the PDB-style file with coordinates for d4jtxf_.
(The format of our PDB-style files is described here.)

Timeline for d4jtxf_: