Lineage for d1quqb_ (1quq B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668080Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 668144Protein Replication protein A 14 KDa (RPA14) subunit [50271] (1 species)
  7. 668145Species Human (Homo sapiens) [TaxId:9606] [50272] (2 PDB entries)
  8. 668146Domain d1quqb_: 1quq B: [25305]
    Other proteins in same PDB: d1quqa_, d1quqc_

Details for d1quqb_

PDB Entry: 1quq (more details), 2.5 Å

PDB Description: complex of replication protein a subunits rpa14 and rpa32
PDB Compounds: (B:) protein (replication protein a 14 kd subunit)

SCOP Domain Sequences for d1quqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1quqb_ b.40.4.3 (B:) Replication protein A 14 KDa (RPA14) subunit {Human (Homo sapiens) [TaxId: 9606]}
dmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmepldee
isgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplg

SCOP Domain Coordinates for d1quqb_:

Click to download the PDB-style file with coordinates for d1quqb_.
(The format of our PDB-style files is described here.)

Timeline for d1quqb_: