SCOP 1.61: Domain d1quqb_: 1quq B:

Lineage for d1quqb_ (1quq B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (7 proteins)

6. Protein Replication protein A 14 KDa (RPA14) subunit [50271] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50272] (2 PDB entries)

8. Domain d1quqb_: 1quq B: [25305]
   Other proteins in same PDB: d1quqa_, d1quqc_

Details for d1quqb_

PDB Entry: 1quq, 2.5 Å

PDB Description: complex of replication protein a subunits rpa14 and rpa32

SCOP Domain Sequences for d1quqb_:

Sequence; same for both SEQRES and ATOM records:

>d1quqb_ b.40.4.3 (B:) Replication protein A 14 KDa (RPA14) subunit {Human (Homo sapiens)}
dmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmepldee
isgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplg

Timeline for d1quqb_:

• d1quqb_ first appeared (with stable ids) in SCOP 1.55
  
• d1quqb_ appears in SCOP 1.59
  
• d1quqb_ appears in SCOP 1.63
  
• d1quqb_ appears in the current release, SCOPe 2.08