Lineage for d1quqb_ (1quq B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14109Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (6 proteins)
  6. 14113Protein Replication protein A 14 KDa (RPA14) subunit [50271] (1 species)
  7. 14114Species Human (Homo sapiens) [TaxId:9606] [50272] (1 PDB entry)
  8. 14115Domain d1quqb_: 1quq B: [25305]
    Other proteins in same PDB: d1quqa_, d1quqc_

Details for d1quqb_

PDB Entry: 1quq (more details), 2.5 Å

PDB Description: complex of replication protein a subunits rpa14 and rpa32

SCOP Domain Sequences for d1quqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1quqb_ b.40.4.3 (B:) Replication protein A 14 KDa (RPA14) subunit {Human (Homo sapiens)}
dmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmepldee
isgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplg

SCOP Domain Coordinates for d1quqb_:

Click to download the PDB-style file with coordinates for d1quqb_.
(The format of our PDB-style files is described here.)

Timeline for d1quqb_: