Lineage for d4jtxb_ (4jtx B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969580Protein Influenza hemagglutinin (stalk) [58066] (8 species)
    trimer
  7. 1969596Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)
  8. 1969744Domain d4jtxb_: 4jtx B: [253049]
    Other proteins in same PDB: d4jtxa_, d4jtxc_, d4jtxe_, d4jtxg_, d4jtxi_, d4jtxk_
    automated match to d1rd8b_
    complexed with nag; mutant

Details for d4jtxb_

PDB Entry: 4jtx (more details), 3 Å

PDB Description: crystal structure of 2009 pandemic influenza virus hemagglutinin mutant d225e
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4jtxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jtxb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypky

SCOPe Domain Coordinates for d4jtxb_:

Click to download the PDB-style file with coordinates for d4jtxb_.
(The format of our PDB-style files is described here.)

Timeline for d4jtxb_: