Lineage for d1quqc_ (1quq C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2051200Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 protein domains)
    barrel, closed; n=5, S=10
  6. 2051268Protein Replication protein A 32 KDa subunit (RPA32) fragment [50269] (1 species)
  7. 2051269Species Human (Homo sapiens) [TaxId:9606] [50270] (5 PDB entries)
  8. 2051275Domain d1quqc_: 1quq C: [25304]
    Other proteins in same PDB: d1quqb_, d1quqd_
    protein/DNA complex

Details for d1quqc_

PDB Entry: 1quq (more details), 2.5 Å

PDB Description: complex of replication protein a subunits rpa14 and rpa32
PDB Compounds: (C:) protein (replication protein a 32 kd subunit)

SCOPe Domain Sequences for d1quqc_:

Sequence, based on SEQRES records: (download)

>d1quqc_ b.40.4.3 (C:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}
hivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmdv
rqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevin
ahmvlsk

Sequence, based on observed residues (ATOM records): (download)

>d1quqc_ b.40.4.3 (C:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}
hivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmdv
rqwvntvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevinahmvlsk

SCOPe Domain Coordinates for d1quqc_:

Click to download the PDB-style file with coordinates for d1quqc_.
(The format of our PDB-style files is described here.)

Timeline for d1quqc_: