Lineage for d4jtrb_ (4jtr B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829137Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2829157Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species)
  7. 2829158Species Human (Homo sapiens), type III [TaxId:9606] [69383] (16 PDB entries)
    bile acid binding protein
  8. 2829162Domain d4jtrb_: 4jtr B: [253033]
    automated match to d4jqab_
    complexed with edo, ibp, izp, nap, po4, tla

Details for d4jtrb_

PDB Entry: 4jtr (more details), 1.3 Å

PDB Description: AKR1C2 complex with ibuprofen
PDB Compounds: (B:) Aldo-keto reductase family 1 member C2

SCOPe Domain Sequences for d4jtrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jtrb_ c.1.7.1 (B:) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III [TaxId: 9606]}
skyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeqvg
lairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpvsv
kpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpgl
kykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvlc
alakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnrn
vryltldifagppnypf

SCOPe Domain Coordinates for d4jtrb_:

Click to download the PDB-style file with coordinates for d4jtrb_.
(The format of our PDB-style files is described here.)

Timeline for d4jtrb_: