Lineage for d4jt0t_ (4jt0 T:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1937404Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 1937405Protein automated matches [190509] (10 species)
    not a true protein
  7. 1937446Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (9 PDB entries)
  8. 1937460Domain d4jt0t_: 4jt0 T: [253023]
    Other proteins in same PDB: d4jt0a_, d4jt0b_, d4jt0e_, d4jt0g_, d4jt0h_, d4jt0i_, d4jt0j_, d4jt0k_, d4jt0l_, d4jt0m_, d4jt0n_, d4jt0o_, d4jt0p_, d4jt0s_, d4jt0u_, d4jt0v_, d4jt0w_, d4jt0x_, d4jt0y_, d4jt0z_
    automated match to d1irug_
    complexed with 0l1, mes

Details for d4jt0t_

PDB Entry: 4jt0 (more details), 3.1 Å

PDB Description: yeast 20s proteasome in complex with the dimerized linear mimetic of tmc-95a - ycp:4a
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4jt0t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jt0t_ d.153.1.0 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOPe Domain Coordinates for d4jt0t_:

Click to download the PDB-style file with coordinates for d4jt0t_.
(The format of our PDB-style files is described here.)

Timeline for d4jt0t_: