SCOP 1.67: Domain d1jmca1: 1jmc A:183-298

Lineage for d1jmca1 (1jmc A:183-298)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
   barrel, closed; n=5, S=10

6. Protein Replication protein A 70 KDa subunit (RPA70) [50267] (1 species)
   duplication: consists of three domains of this fold; contains zinc-finger insert in the C-terminal domain, residues 479-511

7. Species Human (Homo sapiens) [TaxId:9606] [50268] (4 PDB entries)

8. Domain d1jmca1: 1jmc A:183-298 [25300]

Details for d1jmca1

PDB Entry: 1jmc, 2.4 Å

PDB Description: single stranded dna-binding domain of human replication protein a bound to single stranded dna, rpa70 subunit, residues 183-420

SCOP Domain Sequences for d1jmca1:

Sequence; same for both SEQRES and ATOM records:

>d1jmca1 b.40.4.3 (A:183-298) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens)}
kvvpiasltpyqskwticarvtnksqirtwsnsrgegklfslelvdesgeiratafneqv
dkffplievnkvyyfskgtlkiankqftavkndyemtfnnetsvmpceddhhlptv

Timeline for d1jmca1:

• d1jmca1 first appeared (with stable ids) in SCOP 1.55
  
• d1jmca1 appears in SCOP 1.65
  
• d1jmca1 appears in SCOP 1.69
  
• d1jmca1 appears in the current release, SCOPe 2.08