Lineage for d4jo4m1 (4jo4 M:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761410Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries)
  8. 2761469Domain d4jo4m1: 4jo4 M:1-107 [252994]
    automated match to d4jo3l1
    complexed with 1pe, so4

Details for d4jo4m1

PDB Entry: 4jo4 (more details), 2.27 Å

PDB Description: crystal structure of rabbit mab r20 fab
PDB Compounds: (M:) monoclonal anti-HIV-1 gp120 V3 antibody R20 light chain

SCOPe Domain Sequences for d4jo4m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jo4m1 b.1.1.0 (M:1-107) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
divmtqtpasvsaavggtvtincqasetisnylawyqqkpgqppklliykastlasgvss
rfkgsgsgteytltisgvqcddaatyycqqgysisdidnsfgggtevvvk

SCOPe Domain Coordinates for d4jo4m1:

Click to download the PDB-style file with coordinates for d4jo4m1.
(The format of our PDB-style files is described here.)

Timeline for d4jo4m1: