Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (19 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (12 PDB entries) |
Domain d4jo4l1: 4jo4 L:1-107 [252992] automated match to d4jo3l1 complexed with 1pe, so4 |
PDB Entry: 4jo4 (more details), 2.27 Å
SCOPe Domain Sequences for d4jo4l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jo4l1 b.1.1.0 (L:1-107) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} divmtqtpasvsaavggtvtincqasetisnylawyqqkpgqppklliykastlasgvss rfkgsgsgteytltisgvqcddaatyycqqgysisdidnsfgggtevvvk
Timeline for d4jo4l1: