SCOPe 2.05: Domain d4jo1m2: 4jo1 M:109-211

Lineage for d4jo1m2 (4jo1 M:109-211)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (15 PDB entries)

8. Domain d4jo1m2: 4jo1 M:109-211 [252991]
   automated match to d4jo2m2
   complexed with ca

Details for d4jo1m2

PDB Entry: 4jo1, 2.03 Å

PDB Description: Crystal structure of rabbit mAb R56 Fab in complex with V3 crown of HIV-1 JR-FL gp120

PDB Compounds: (M:) monoclonal anti-HIV-1 gp120 V3 antibody R56 light chain

SCOPe Domain Sequences for d4jo1m2:

Sequence; same for both SEQRES and ATOM records:

>d4jo1m2 b.1.1.0 (M:109-211) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dpvaptvlifppaadqvatgtvtivcvankyfpdvtvtwevdgttqttgiensktpqnsa
dctynlsstltltstqynshkeytckvtqgttsvvqsfnrgdc

Timeline for d4jo1m2:

• d4jo1m2 first appeared in SCOPe 2.04
  
• d4jo1m2 appears in SCOPe 2.06
  
• d4jo1m2 appears in the current release, SCOPe 2.08