Lineage for d4jo1m2 (4jo1 M:109-211)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1521191Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (12 PDB entries)
  8. 1521207Domain d4jo1m2: 4jo1 M:109-211 [252991]
    automated match to d4jo2m2
    complexed with ca

Details for d4jo1m2

PDB Entry: 4jo1 (more details), 2.03 Å

PDB Description: Crystal structure of rabbit mAb R56 Fab in complex with V3 crown of HIV-1 JR-FL gp120
PDB Compounds: (M:) monoclonal anti-HIV-1 gp120 V3 antibody R56 light chain

SCOPe Domain Sequences for d4jo1m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jo1m2 b.1.1.0 (M:109-211) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dpvaptvlifppaadqvatgtvtivcvankyfpdvtvtwevdgttqttgiensktpqnsa
dctynlsstltltstqynshkeytckvtqgttsvvqsfnrgdc

SCOPe Domain Coordinates for d4jo1m2:

Click to download the PDB-style file with coordinates for d4jo1m2.
(The format of our PDB-style files is described here.)

Timeline for d4jo1m2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jo1m1