SCOP 1.55: Domain d1fgub2: 1fgu B:298-426

Lineage for d1fgub2 (1fgu B:298-426)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (6 proteins)

6. Protein Replication protein A 70 KDa subunit (RPA70) fragment [50267] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50268] (3 PDB entries)

8. Domain d1fgub2: 1fgu B:298-426 [25299]

Details for d1fgub2

PDB Entry: 1fgu, 2.5 Å

PDB Description: ssdna-binding domain of the large subunit of replication protein a

SCOP Domain Sequences for d1fgub2:

Sequence; same for both SEQRES and ATOM records:

>d1fgub2 b.40.4.3 (B:298-426) Replication protein A 70 KDa subunit (RPA70) fragment {Human (Homo sapiens)}
vqfdftgiddlenkskdslvdiigicksyedatkitvrsnnrevakrniylmdtsgkvvt
atlwgedadkfdgsrqpvlaikgarvsdfggrslsvlssstiianpdipeayklrgwfda
egqaldgvs

Timeline for d1fgub2:

• d1fgub2 appears in SCOP 1.57
  
• d1fgub2 appears in the current release, SCOPe 2.08