SCOPe 2.06: Domain d4jo1l1: 4jo1 L:2-108

Lineage for d4jo1l1 (4jo1 L:2-108)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (17 PDB entries)

8. Domain d4jo1l1: 4jo1 L:2-108 [252988]
   automated match to d4jo2m1
   complexed with ca

Details for d4jo1l1

PDB Entry: 4jo1, 2.03 Å

PDB Description: Crystal structure of rabbit mAb R56 Fab in complex with V3 crown of HIV-1 JR-FL gp120

PDB Compounds: (L:) monoclonal anti-HIV-1 gp120 V3 antibody R56 light chain

SCOPe Domain Sequences for d4jo1l1:

Sequence; same for both SEQRES and ATOM records:

>d4jo1l1 b.1.1.0 (L:2-108) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qvltqtpssvstavgsavtincqssqnvysnnnlawfqqkpgqpprlliydasklasgvp
srfkgsgsgtqftftisdvqcddaatfyclggydcssgdcaafgggtevvvrg

Timeline for d4jo1l1:

• d4jo1l1 first appeared in SCOPe 2.04
  
• d4jo1l1 appears in SCOPe 2.05
  
• d4jo1l1 appears in SCOPe 2.07
  
• d4jo1l1 appears in the current release, SCOPe 2.08