Lineage for d4jm2e_ (4jm2 E:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2560277Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 2560278Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 2560279Family d.172.1.1: gp120 core [56503] (2 proteins)
  6. 2560307Protein automated matches [190166] (1 species)
    not a true protein
  7. 2560308Species Human immunodeficiency virus 1 [TaxId:11676] [186893] (4 PDB entries)
  8. 2560312Domain d4jm2e_: 4jm2 E: [252984]
    Other proteins in same PDB: d4jm2b1, d4jm2b2, d4jm2c1, d4jm2c2, d4jm2f1, d4jm2f2
    automated match to d2b4cg1
    complexed with nag, pg4

Details for d4jm2e_

PDB Entry: 4jm2 (more details), 3.1 Å

PDB Description: Crystal Structure of PGT 135 Fab in Complex with gp120 Core Protein from HIV-1 Strain JR-FL Bound to CD4 and 17b Fab
PDB Compounds: (E:) gp120

SCOPe Domain Sequences for d4jm2e_:

Sequence, based on SEQRES records: (download)

>d4jm2e_ d.172.1.1 (E:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
vtehfnmwknnmveqmqediislwdqslkpcvkltplcvgsgscdtsvitqacpkisfep
ipihycapagfailkcndktfngkgpcknvstvqcthgirpvvstqlllngslaeeevvi
rsdnftnnaktiivqlkesveinctrpnnntrpgeiigdirqahcnisrakwndtlkqiv
iklreqfenktivfnhssggdpeivmhsfncggeffycnstqlfnstwnnntegsnnteg
ntitlpcrikqiinmwqevgkamyappirgqircssnitgllltrdgginengteifrpg
ggdmrdnwrselykykvvki

Sequence, based on observed residues (ATOM records): (download)

>d4jm2e_ d.172.1.1 (E:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
vtehfnmwknnmveqmqediislwdqslkpcvkltplcvgsgscdtsvitqacpkisfep
ipihycapagfailkcndktfngkgpcknvstvqcthgirpvvstqlllngslaeeevvi
rsdnftnnaktiivqlkesveinctrpnnntigdirqahcnisrakwndtlkqiviklre
qfenktivfnhssggdpeivmhsfncggeffycnstqlfnstwnnntegsnntegntitl
pcrikqiinmwqevgkamyappirgqircssnitgllltrdgginengteifrpgggdmr
dnwrselykykvvki

SCOPe Domain Coordinates for d4jm2e_:

Click to download the PDB-style file with coordinates for d4jm2e_.
(The format of our PDB-style files is described here.)

Timeline for d4jm2e_: