Lineage for d4jm2c1 (4jm2 C:1-109)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743344Domain d4jm2c1: 4jm2 C:1-109 [252982]
    Other proteins in same PDB: d4jm2a_, d4jm2b1, d4jm2b2, d4jm2c2, d4jm2e_, d4jm2f1, d4jm2f2
    automated match to d2nxyc1
    complexed with nag, pg4

Details for d4jm2c1

PDB Entry: 4jm2 (more details), 3.1 Å

PDB Description: crystal structure of pgt 135 fab in complex with gp120 core protein from hiv-1 strain jr-fl bound to cd4 and 17b fab
PDB Compounds: (C:) 17b Light chain

SCOPe Domain Sequences for d4jm2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jm2c1 b.1.1.1 (C:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa
rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleikrt

SCOPe Domain Coordinates for d4jm2c1:

Click to download the PDB-style file with coordinates for d4jm2c1.
(The format of our PDB-style files is described here.)

Timeline for d4jm2c1: