Lineage for d1fgub1 (1fgu B:181-289)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59438Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 59495Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (6 proteins)
  6. 59508Protein Replication protein A 70 KDa subunit (RPA70) fragment [50267] (1 species)
  7. 59509Species Human (Homo sapiens) [TaxId:9606] [50268] (3 PDB entries)
  8. 59512Domain d1fgub1: 1fgu B:181-289 [25298]

Details for d1fgub1

PDB Entry: 1fgu (more details), 2.5 Å

PDB Description: ssdna-binding domain of the large subunit of replication protein a

SCOP Domain Sequences for d1fgub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fgub1 b.40.4.3 (B:181-289) Replication protein A 70 KDa subunit (RPA70) fragment {Human (Homo sapiens)}
mskvvpiasltpyqskwticarvtnksqirtwsnsrgegklfslelvdesgeiratafne
qvdkffplievnkvyyfskgtlkiankqftavkndyemtfnnetsvmpc

SCOP Domain Coordinates for d1fgub1:

Click to download the PDB-style file with coordinates for d1fgub1.
(The format of our PDB-style files is described here.)

Timeline for d1fgub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fgub2