Lineage for d4jlzb2 (4jlz B:383-497)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735618Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 2735619Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 2735690Family a.160.1.6: cGAMP synthase, cGAS C-terminal domain [254175] (1 protein)
    PubMed 23647843; structurally very similar to hOAS1 (a.160.1.2)
  6. 2735691Protein cGAMP synthase, cGAS C-terminal domain [254395] (2 species)
  7. 2735697Species Pig (Sus scrofa) [TaxId:9823] [256337] (2 PDB entries)
  8. 2735700Domain d4jlzb2: 4jlz B:383-497 [252979]
    Other proteins in same PDB: d4jlza1, d4jlzb1
    automated match to d4k8va2
    protein/DNA complex; complexed with mg, utp, zn

Details for d4jlzb2

PDB Entry: 4jlz (more details), 2.27 Å

PDB Description: Structure of porcine cGAS in complex with bound UTP
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d4jlzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jlzb2 a.160.1.6 (B:383-497) cGAMP synthase, cGAS C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
rkeclklmkylleqlkkkfgnrrelakfcsyhvktaffhvctqdphdnqwhlknleccfd
ncvayflqclkteqlanyfipgvnlfsrdlidkpskeflskqieyernngfpvfw

SCOPe Domain Coordinates for d4jlzb2:

Click to download the PDB-style file with coordinates for d4jlzb2.
(The format of our PDB-style files is described here.)

Timeline for d4jlzb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jlzb1