SCOPe 2.06: Domain d4jlza2: 4jlz A:383-497

Lineage for d4jlza2 (4jlz A:383-497)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.6: cGAMP synthase, cGAS C-terminal domain [254175] (1 protein)
   PubMed 23647843; structurally very similar to hOAS1 (a.160.1.2)

6. Protein cGAMP synthase, cGAS C-terminal domain [254395] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [256337] (2 PDB entries)

8. Domain d4jlza2: 4jlz A:383-497 [252977]
   Other proteins in same PDB: d4jlza1, d4jlzb1
   automated match to d4k8va2
   protein/DNA complex; complexed with mg, utp, zn

Details for d4jlza2

PDB Entry: 4jlz, 2.27 Å

PDB Description: Structure of porcine cGAS in complex with bound UTP

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d4jlza2:

Sequence; same for both SEQRES and ATOM records:

>d4jlza2 a.160.1.6 (A:383-497) cGAMP synthase, cGAS C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
rkeclklmkylleqlkkkfgnrrelakfcsyhvktaffhvctqdphdnqwhlknleccfd
ncvayflqclkteqlanyfipgvnlfsrdlidkpskeflskqieyernngfpvfw

Timeline for d4jlza2:

• d4jlza2 first appeared in SCOPe 2.04
  
• d4jlza2 appears in SCOPe 2.05
  
• d4jlza2 appears in SCOPe 2.07
  
• d4jlza2 appears in the current release, SCOPe 2.08