Lineage for d4jlmb_ (4jlm B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2865780Protein Deoxycytidine kinase [89657] (1 species)
  7. 2865781Species Human (Homo sapiens) [TaxId:9606] [89658] (45 PDB entries)
  8. 2865837Domain d4jlmb_: 4jlm B: [252971]
    automated match to d1p60a_
    complexed with 1nn, udp; mutant

    has additional insertions and/or extensions that are not grouped together

Details for d4jlmb_

PDB Entry: 4jlm (more details), 2.18 Å

PDB Description: human dck c4s-s74e mutant in complex with udp and the f2.3.1 inhibitor (2-[({5-ethyl-2-[3-(2-fluoroethoxy)-4-methoxyphenyl]-1,3-thiazol-4-yl}methyl)sulfanyl]pyrimidine-4,6-diamine)
PDB Compounds: (B:) Deoxycytidine kinase

SCOPe Domain Sequences for d4jlmb_:

Sequence, based on SEQRES records: (download)

>d4jlmb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}
trikkisiegniaagkstfvnilkqlsedwevvpepvarwsnvqstqdefeeltmeqkng
gnvlqmmyekperwsftfqtyaclsriraqlaslngklkdaekpvlffersvysdryifa
snlyesesmnetewtiyqdwhdwmnnqfgqsleldgiiylqatpetclhriylrgrneeq
gipleyleklhykheswllhrtlktnfdylqevpiltldvnedfkdkyeslvekvkefls
tl

Sequence, based on observed residues (ATOM records): (download)

>d4jlmb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}
trikkisiegniaagkstfvnilkqlsedwevvpepvarwsneltmeqknggnvlqmmye
kperwsftfqtyaclsriraqlaslngklkdaekpvlffersvysdryifasnlyesesm
netewtiyqdwhdwmnnqfgqsleldgiiylqatpetclhriylrgrneeqgipleylek
lhykheswllhrtlktnfdylqevpiltldvnedfkdkyeslvekvkeflstl

SCOPe Domain Coordinates for d4jlmb_:

Click to download the PDB-style file with coordinates for d4jlmb_.
(The format of our PDB-style files is described here.)

Timeline for d4jlmb_: