SCOPe 2.08: Domain d1fgua1: 1fgu A:181-298

Lineage for d1fgua1 (1fgu A:181-298)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
   barrel, closed; n=5, S=10

6. Protein Replication protein A 70 KDa subunit (RPA70) [50267] (1 species)
   duplication: consists of three domains of this fold; contains zinc-finger insert in the C-terminal domain, residues 479-511

7. Species Human (Homo sapiens) [TaxId:9606] [50268] (4 PDB entries)

8. Domain d1fgua1: 1fgu A:181-298 [25296]
   the N-terminal two domains free

Details for d1fgua1

PDB Entry: 1fgu, 2.5 Å

PDB Description: ssdna-binding domain of the large subunit of replication protein a

PDB Compounds: (A:) Replication protein A 70 kDa DNA-binding subunit

SCOPe Domain Sequences for d1fgua1:

Sequence; same for both SEQRES and ATOM records:

>d1fgua1 b.40.4.3 (A:181-298) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]}
mskvvpiasltpyqskwticarvtnksqirtwsnsrgegklfslelvdesgeiratafne
qvdkffplievnkvyyfskgtlkiankqftavkndyemtfnnetsvmpceddhhlptv

Timeline for d1fgua1:

• d1fgua1 first appeared (with stable ids) in SCOP 1.55
  
• d1fgua1 appears in SCOPe 2.07