SCOPe 2.05: Domain d4jjnl_: 4jjn L:

Lineage for d4jjnl_ (4jjn L:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.12: BAH domain [82061] (2 families)

5. Family b.34.12.0: automated matches [191438] (1 protein)
   not a true family

6. Protein automated matches [190644] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [235233] (3 PDB entries)

8. Domain d4jjnl_: 4jjn L: [252959]
   Other proteins in same PDB: d4jjnb_, d4jjnc_, d4jjnd_, d4jjnf_, d4jjng_, d4jjnh_
   automated match to d4kuia_
   protein/DNA complex

Details for d4jjnl_

PDB Entry: 4jjn, 3.09 Å

PDB Description: Crystal structure of heterochromatin protein Sir3 in complex with a silenced yeast nucleosome

PDB Compounds: (L:) Regulatory protein SIR3

SCOPe Domain Sequences for d4jjnl_:

Sequence, based on SEQRES records:

>d4jjnl_ b.34.12.0 (L:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tlkdldgwqviitddqgrviddnnrrrsrkrggenvflkrisdglsfgkgesvifndnvt
etysvyliheirlntlnnvveiwvfsylrwfelkpklyyeqfrpdlikedhplefykdkf
fnevnkselyltaelseiwlkdfiavgqilpesqwndssidkiedrdflvryaceptaek
fvpidifqiirrvkemepkqsneylkrvsvpvsgq

Sequence, based on observed residues (ATOM records):

>d4jjnl_ b.34.12.0 (L:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tlkdldgwqviitddqgrvirrrsrkrggenvflkrisdglsfgkgesvifndnvtetys
vyliheirlntlnnvveiwvfsylrwfelkpklyyeqfrpdlikedhplefykdkffnev
nkselyltaelseiwlkdfiavgqilpesqwndssidkiedrdflvryaceptaekfvpi
difqiirrvkemepkqsneylkrvsvpvsgq

Timeline for d4jjnl_:

• d4jjnl_ first appeared in SCOPe 2.04
  
• d4jjnl_ appears in SCOPe 2.06
  
• d4jjnl_ appears in the current release, SCOPe 2.08