Lineage for d4jjnk_ (4jjn K:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784999Superfamily b.34.12: BAH domain [82061] (2 families) (S)
  5. 2785022Family b.34.12.0: automated matches [191438] (1 protein)
    not a true family
  6. 2785023Protein automated matches [190644] (2 species)
    not a true protein
  7. 2785028Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [235233] (3 PDB entries)
  8. 2785031Domain d4jjnk_: 4jjn K: [252958]
    Other proteins in same PDB: d4jjnb_, d4jjnc_, d4jjnd_, d4jjnf_, d4jjng_, d4jjnh_
    automated match to d4kuia_
    protein/DNA complex

Details for d4jjnk_

PDB Entry: 4jjn (more details), 3.09 Å

PDB Description: Crystal structure of heterochromatin protein Sir3 in complex with a silenced yeast nucleosome
PDB Compounds: (K:) Regulatory protein SIR3

SCOPe Domain Sequences for d4jjnk_:

Sequence, based on SEQRES records: (download)

>d4jjnk_ b.34.12.0 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
aktlkdldgwqviitddqgrviddnnrrrsrkrggenvflkrisdglsfgkgesvifndn
vtetysvyliheirlntlnnvveiwvfsylrwfelkpklyyeqfrpdlikedhplefykd
kffnevnkselyltaelseiwlkdfiavgqilpesqwndssidkiedrdflvryacepta
ekfvpidifqiirrvkemepkqsneylkrvsvp

Sequence, based on observed residues (ATOM records): (download)

>d4jjnk_ b.34.12.0 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
akdldgwqviitddqviddnnrrrsrkenvflkrisdglsfgkgesvifndnvtetysvy
liheirlntlnnvveiwvfsylrwfelkpklyyeqfrpdlikedhplefykdkffnevnk
selyltaelseiwlkdfiavgqilpesqwndssidkiedrdflvryaceptaekfvpidi
fqiirrvkemepkqsneylkrvsvp

SCOPe Domain Coordinates for d4jjnk_:

Click to download the PDB-style file with coordinates for d4jjnk_.
(The format of our PDB-style files is described here.)

Timeline for d4jjnk_: