Lineage for d4jjnh_ (4jjn H:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482597Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1482598Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1482599Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1483034Protein automated matches [193445] (6 species)
    not a true protein
  7. 1483040Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256335] (1 PDB entry)
  8. 1483046Domain d4jjnh_: 4jjn H: [252957]
    Other proteins in same PDB: d4jjnk_, d4jjnl_
    automated match to d1s32d_
    protein/DNA complex

Details for d4jjnh_

PDB Entry: 4jjn (more details), 3.09 Å

PDB Description: Crystal structure of heterochromatin protein Sir3 in complex with a silenced yeast nucleosome
PDB Compounds: (H:) histone h2b.2

SCOPe Domain Sequences for d4jjnh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jjnh_ a.22.1.1 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisare
iqtavrlilpgelakhavsegtravtkyssst

SCOPe Domain Coordinates for d4jjnh_:

Click to download the PDB-style file with coordinates for d4jjnh_.
(The format of our PDB-style files is described here.)

Timeline for d4jjnh_: