Class a: All alpha proteins [46456] (285 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (6 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256335] (1 PDB entry) |
Domain d4jjnh_: 4jjn H: [252957] Other proteins in same PDB: d4jjnk_, d4jjnl_ automated match to d1s32d_ protein/DNA complex |
PDB Entry: 4jjn (more details), 3.09 Å
SCOPe Domain Sequences for d4jjnh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jjnh_ a.22.1.1 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisare iqtavrlilpgelakhavsegtravtkyssst
Timeline for d4jjnh_: