SCOPe 2.07: Domain d4jjng_: 4jjn G:

Lineage for d4jjng_ (4jjn G:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (6 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256335] (4 PDB entries)

8. Domain d4jjng_: 4jjn G: [252956]
   Other proteins in same PDB: d4jjnk_, d4jjnl_
   automated match to d1id3c_
   protein/DNA complex

Details for d4jjng_

PDB Entry: 4jjn, 3.09 Å

PDB Description: Crystal structure of heterochromatin protein Sir3 in complex with a silenced yeast nucleosome

PDB Compounds: (G:) Histone H2A.2

SCOPe Domain Sequences for d4jjng_:

Sequence; same for both SEQRES and ATOM records:

>d4jjng_ a.22.1.1 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
qsrsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleylaaeilelagnaardnk
ktriiprhlqlairnddelnkllgnvtiaqggvlpnihqnllpkks

Timeline for d4jjng_:

• d4jjng_ first appeared in SCOPe 2.04
  
• d4jjng_ appears in SCOPe 2.06