Lineage for d4jjng_ (4jjn G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698677Protein automated matches [193445] (8 species)
    not a true protein
  7. 2698706Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256335] (7 PDB entries)
  8. 2698727Domain d4jjng_: 4jjn G: [252956]
    Other proteins in same PDB: d4jjnk_, d4jjnl_
    automated match to d1id3c_
    protein/DNA complex

Details for d4jjng_

PDB Entry: 4jjn (more details), 3.09 Å

PDB Description: Crystal structure of heterochromatin protein Sir3 in complex with a silenced yeast nucleosome
PDB Compounds: (G:) Histone H2A.2

SCOPe Domain Sequences for d4jjng_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jjng_ a.22.1.1 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
qsrsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleylaaeilelagnaardnk
ktriiprhlqlairnddelnkllgnvtiaqggvlpnihqnllpkks

SCOPe Domain Coordinates for d4jjng_:

Click to download the PDB-style file with coordinates for d4jjng_.
(The format of our PDB-style files is described here.)

Timeline for d4jjng_: