SCOPe 2.01: Domain d1eygd_: 1eyg D:

Lineage for d1eygd_ (1eyg D:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
   barrel, closed; n=5, S=10

6. Protein ssDNA-binding protein [50264] (4 species)

7. Species Escherichia coli [TaxId:562] [50266] (5 PDB entries)
   Uniprot P02339

8. Domain d1eygd_: 1eyg D: [25295]
   protein/DNA complex

Details for d1eygd_

PDB Entry: 1eyg, 2.8 Å

PDB Description: Crystal structure of chymotryptic fragment of E. coli ssb bound to two 35-mer single strand DNAS

PDB Compounds: (D:) single-strand DNA-binding protein

SCOPe Domain Sequences for d1eygd_:

Sequence, based on SEQRES records:

>d1eygd_ b.40.4.3 (D:) ssDNA-binding protein {Escherichia coli [TaxId: 562]}
asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggr

Sequence, based on observed residues (ATOM records):

>d1eygd_ b.40.4.3 (D:) ssDNA-binding protein {Escherichia coli [TaxId: 562]}
asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkamkeqtewhrvvlfgkl
aevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggr

Timeline for d1eygd_:

• d1eygd_ first appeared (with stable ids) in SCOP 1.55
  
• d1eygd_ appears in SCOP 1.75
  
• d1eygd_ appears in SCOPe 2.02
  
• d1eygd_ appears in the current release, SCOPe 2.08