SCOPe 2.08: Domain d4jj9c1: 4jj9 C:1-141

Lineage for d4jj9c1 (4jj9 C:1-141)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.0: automated matches [191533] (1 protein)
   not a true family

6. Protein automated matches [190903] (22 species)
   not a true protein

7. Species Bordetella bronchiseptica [TaxId:257310] [256334] (1 PDB entry)

8. Domain d4jj9c1: 4jj9 C:1-141 [252949]
   Other proteins in same PDB: d4jj9a2, d4jj9b2, d4jj9c2
   automated match to d4jcua_
   complexed with so4

Details for d4jj9c1

PDB Entry: 4jj9, 1.76 Å

PDB Description: Crystal Structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase

PDB Compounds: (C:) 5-carboxymethyl-2-hydroxymuconate delta-isomerase

SCOPe Domain Sequences for d4jj9c1:

Sequence; same for both SEQRES and ATOM records:

>d4jj9c1 d.80.1.0 (C:1-141) automated matches {Bordetella bronchiseptica [TaxId: 257310]}
mphlvilysgnldrdldmgavcrgladamltvrddegrqvfptggtrvlaypaphyaiad
ggqagrdagesgdygfaylnlrmgrgrseavqrragetiaqaarallapllqqrrvgltf
qidvgaevydakfgnlhalfq

Timeline for d4jj9c1:

• d4jj9c1 first appeared in SCOPe 2.04, called d4jj9c_
  
• d4jj9c1 appears in SCOPe 2.07