Lineage for d4jgzc_ (4jgz C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822534Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2822535Protein automated matches [190988] (51 species)
    not a true protein
  7. 2822644Species Human coxsackievirus a16 [TaxId:31704] [256333] (2 PDB entries)
  8. 2822650Domain d4jgzc_: 4jgz C: [252942]
    automated match to d1cov3_

Details for d4jgzc_

PDB Entry: 4jgz (more details), 3 Å

PDB Description: Crystal structure of human coxsackievirus A16 uncoating intermediate (space group I222)
PDB Compounds: (C:) Polyprotein, capsid protein VP3

SCOPe Domain Sequences for d4jgzc_:

Sequence, based on SEQRES records: (download)

>d4jgzc_ b.121.4.0 (C:) automated matches {Human coxsackievirus a16 [TaxId: 31704]}
giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt
nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm
fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyrah
aragyfdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdtedie

Sequence, based on observed residues (ATOM records): (download)

>d4jgzc_ b.121.4.0 (C:) automated matches {Human coxsackievirus a16 [TaxId: 31704]}
giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt
nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm
fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyray
fdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdtedie

SCOPe Domain Coordinates for d4jgzc_:

Click to download the PDB-style file with coordinates for d4jgzc_.
(The format of our PDB-style files is described here.)

Timeline for d4jgzc_: