Class b: All beta proteins [48724] (177 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (13 species) not a true protein |
Species Human coxsackievirus a16 [TaxId:31704] [256333] (2 PDB entries) |
Domain d4jgyc_: 4jgy C: [252940] automated match to d1cov3_ |
PDB Entry: 4jgy (more details), 3 Å
SCOPe Domain Sequences for d4jgyc_:
Sequence, based on SEQRES records: (download)
>d4jgyc_ b.121.4.0 (C:) automated matches {Human coxsackievirus a16 [TaxId: 31704]} giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyrah aragyfdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdtedie
>d4jgyc_ b.121.4.0 (C:) automated matches {Human coxsackievirus a16 [TaxId: 31704]} giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyray fdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdtedie
Timeline for d4jgyc_: