Lineage for d4jgyc_ (4jgy C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2086604Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2087272Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2087273Protein automated matches [190988] (13 species)
    not a true protein
  7. 2087314Species Human coxsackievirus a16 [TaxId:31704] [256333] (2 PDB entries)
  8. 2087317Domain d4jgyc_: 4jgy C: [252940]
    automated match to d1cov3_

Details for d4jgyc_

PDB Entry: 4jgy (more details), 3 Å

PDB Description: Crystal structure of human coxsackievirus A16 uncoating intermediate (space group P4232)
PDB Compounds: (C:) Polyprotein, capsid protein VP3

SCOPe Domain Sequences for d4jgyc_:

Sequence, based on SEQRES records: (download)

>d4jgyc_ b.121.4.0 (C:) automated matches {Human coxsackievirus a16 [TaxId: 31704]}
giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt
nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm
fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyrah
aragyfdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdtedie

Sequence, based on observed residues (ATOM records): (download)

>d4jgyc_ b.121.4.0 (C:) automated matches {Human coxsackievirus a16 [TaxId: 31704]}
giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt
nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm
fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyray
fdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdtedie

SCOPe Domain Coordinates for d4jgyc_:

Click to download the PDB-style file with coordinates for d4jgyc_.
(The format of our PDB-style files is described here.)

Timeline for d4jgyc_: